DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and ctrb2

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001011477.1 Gene:ctrb2 / 496968 XenbaseID:XB-GENE-1002990 Length:263 Species:Xenopus tropicalis


Alignment Length:278 Identity:93/278 - (33%)
Similarity:145/278 - (52%) Gaps:27/278 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMKLLVCVLLVGS---CTAVPLLTDVEPY--ITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLI 60
            ::.||.|::|:||   |....:...:..|  |.|||.|..|.:|:|..|....|  ..:|||:|:
 Frog     3 LLFLLSCIVLIGSTYGCGVPAIKPIISGYARIVNGENAVSGSWPWQVSLQDRTG--FHFCGGSLV 65

  Fly    61 SHYWIITAAHCMDGAESVT----VYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDIS 121
            ::.|::|||||     .||    |.||..   |.|...:....:..|.:..|.||..:|::|||:
 Frog    66 NNLWVVTAAHC-----GVTTSHRVILGEY---DRSSSAEPIQTMSISRVFKHPNYNTNTMINDIT 122

  Fly   122 LIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSP-VLRYVEMPIMPH 185
            |::|.:...|..|:....:|.. :..|.:.|  |...:||| ..||...:|| .|:.|.:|::.:
 Frog   123 LLKLSSTASFNSRVAPVCIPTS-SEVFNSPE--RCITTGWG-YVDAYSKLSPNKLQQVTLPLLSN 183

  Fly   186 SLCRMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVF 250
            :.|:.||...:...||| :..||.|:|.||||||||..:..:..|.|..|:|:|. |....|.|:
 Frog   184 TECQRYWGNKIHSTMIC-AGASGASSCMGDSGGPLVCARNGAWVLAGIVSWGSST-CSPSSPGVY 246

  Fly   251 TRISSYLDWILNHIIAHN 268
            .|:|:...| ::.|:|.|
 Frog   247 ARVSTLRSW-MDQIVASN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 82/240 (34%)
Tryp_SPc 27..260 CDD:214473 81/237 (34%)
ctrb2NP_001011477.1 Tryp_SPc 34..259 CDD:238113 82/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.