DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG9737

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:292 Identity:90/292 - (30%)
Similarity:130/292 - (44%) Gaps:54/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLTDVEPYITN----GEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWIITAAHCMDGAESVT 79
            ||.:....:||    ||.||:.:||:.|.|..:..::.  |.|.||....|:|||||:.| |.|.
  Fly   138 LLNECGKQVTNRIYGGEIAELDEFPWLALLVYNSNDYG--CSGALIDDRHILTAAHCVQG-EGVR 199

  Fly    80 -------VYLGAINIGDESEEGQE-----------RIMVEKSGIIVHSNY--MASTVVNDISLIR 124
                   |.||..|:..|.:..:|           .|..||  |.||..|  .::...|||::||
  Fly   200 DRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEK--IHVHPEYKEFSNYKYNDIAIIR 262

  Fly   125 LPAFVGFTDRIRAASLPRR------LNGQFPTYESIRAFASGWGRESDASDSV-----SPVLRYV 178
            |...|.||..:....||.:      ..||..:       .||||| :|..:..     ||:...:
  Fly   263 LKHPVSFTHFVMPICLPNKSEPLTLAEGQMFS-------VSGWGR-TDLFNKYFINIHSPIKLKL 319

  Fly   179 EMPIMPHSLCRMYWSG---AVSEKMICMSTTSGKSTCHGDSGGPLVY--KQGNSSYLIGSTSFGT 238
            .:|.:.:..|.....|   .:..|.||......|.||.|||||||:|  :|.:.....|..|:|.
  Fly   320 RIPYVSNENCTKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGF 384

  Fly   239 SMGCQVGFPAVFTRISSYLDWILNHIIAHNKE 270
            :.....|.|||:|.::.|.||| :.::...|:
  Fly   385 TQCGMAGKPAVYTNVAEYTDWI-DSVVQQRKK 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 87/275 (32%)
Tryp_SPc 27..260 CDD:214473 85/272 (31%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 83/269 (31%)
Tryp_SPc 150..409 CDD:238113 85/272 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.