DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:271 Identity:104/271 - (38%)
Similarity:155/271 - (57%) Gaps:27/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVCVLLVGSCTAVPLLTD-------------VEPYITNGEPAEVGQFPYQAGLNV-SFGNWSTWC 55
            |:.:..:|.|:|:.:...             :|..||||..|..||.||..|::: |.||| .||
  Fly     6 LLSLAFLGVCSALTVPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNGNW-WWC 69

  Fly    56 GGTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDI 120
            ||::|.|.|::|||||..||:..::|.||:|.    .|...|..|.....|.:.:|:.  :.:|:
  Fly    70 GGSIIGHTWVLTAAHCTAGADEASLYYGAVNY----NEPAFRHTVSSENFIRYPHYVG--LDHDL 128

  Fly   121 SLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPH 185
            :||:.| .|.|...:....|| .|:.::.:||:....|:|||...|.|:.|.. ||.|::.::..
  Fly   129 ALIKTP-HVDFYSLVNKIELP-SLDDRYNSYENNWVQAAGWGAIYDGSNVVED-LRVVDLKVISV 190

  Fly   186 SLCRMYW-SGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAV 249
            :.|:.|: :...||..||:.|..||:||.||||||||.|:|:.  |||.|||.::.|||||.||.
  Fly   191 AECQAYYGTDTASENTICVETPDGKATCQGDSGGPLVTKEGDK--LIGITSFVSAYGCQVGGPAG 253

  Fly   250 FTRISSYLDWI 260
            |||::.||:||
  Fly   254 FTRVTKYLEWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 99/236 (42%)
Tryp_SPc 27..260 CDD:214473 97/234 (41%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 97/235 (41%)
Tryp_SPc 41..266 CDD:238113 99/236 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470931
Domainoid 1 1.000 182 1.000 Domainoid score I7153
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1010.000

Return to query results.
Submit another query.