DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Jon99Cii

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:273 Identity:118/273 - (43%)
Similarity:152/273 - (55%) Gaps:30/273 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKLLV-CVLLVGSCTAVPL---------LTDVEPYITNGEPAEVGQFPYQAGLNVS-FGNWSTWC 55
            |||.| ..|.|.:.||||.         :.|::..||||.||..|:.||..||..| .|||  ||
  Fly     1 MKLFVFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNW--WC 63

  Fly    56 GGTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDI 120
            ||::|.:.|::|||||.:||..||:..||    ....:.|....|....||.|.:|.:..:.|||
  Fly    64 GGSIIGNTWVLTAAHCTNGASGVTINYGA----SIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDI 124

  Fly   121 SLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPV---LRYVEMPI 182
            ||||.| .|.|...:....|| ..|.::..|....|.|||||...|.    ||:   |:.|::.|
  Fly   125 SLIRTP-HVDFWSLVNKVELP-SYNDRYQDYAGWWAVASGWGGTYDG----SPLPDWLQSVDVQI 183

  Fly   183 MPHSLCRMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFP 247
            :..|.|...||  :.:.|||::|..|||||.||||||||...||.  |:|.||||::.|||.|.|
  Fly   184 ISQSDCSRTWS--LHDNMICINTDGGKSTCGGDSGGPLVTHDGNR--LVGVTSFGSAAGCQSGAP 244

  Fly   248 AVFTRISSYLDWI 260
            |||:|::.|||||
  Fly   245 AVFSRVTGYLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 107/238 (45%)
Tryp_SPc 27..260 CDD:214473 105/236 (44%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 107/238 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470922
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1010.000

Return to query results.
Submit another query.