DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG11841

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:266 Identity:77/266 - (28%)
Similarity:119/266 - (44%) Gaps:55/266 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PYITNGEPAEVGQFPYQAGLNVSFGN----WSTWCGGTLISHYWIITAAHCM--DGAESVTVYLG 83
            |.|.:|.|||..:||:.|.|.....|    |  :|||||||:..::|||||.  :..|...|.||
  Fly    70 PLIVDGTPAEPKEFPFAARLGHRKTNNEIKW--FCGGTLISNRLVLTAAHCFFSEHGEVNVVRLG 132

  Fly    84 AINIGDESEEGQERIMVEKSGII---VHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLPRRLN 145
            .:....::::.:.    |..|::   .|..:....:.|||.:::|...|.|......|.||    
  Fly   133 ELEFDTDTDDAEP----EDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLP---- 189

  Fly   146 GQFPTYESIRAF-ASGWGRESDASDS----------------VSPVLRYVEMPIMPHSLCRMYWS 193
              |...|...:| |.|||::..|...                ||.|....|:|           :
  Fly   190 --FDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELP-----------N 241

  Fly   194 GAVSEKMICMSTTSGKSTCHGDSGGP-LVYKQGNSS--YLIGSTSFGTSMGCQV-GFPAVFTRIS 254
            |...:..:|:.:...|.||:|||||| |.|.:..:.  :::|.||.|.:  |.. ..|:.:||:.
  Fly   242 GYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGIT--CSTPDIPSAYTRVH 304

  Fly   255 SYLDWI 260
            .:|:||
  Fly   305 YFLNWI 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 76/264 (29%)
Tryp_SPc 27..260 CDD:214473 74/262 (28%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 76/264 (29%)
Tryp_SPc 72..310 CDD:214473 74/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.