DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG4815

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:229 Identity:54/229 - (23%)
Similarity:88/229 - (38%) Gaps:47/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PYITNGEPAEVGQFPYQAGLNVS-FGNWSTWCGGTLISHYWIITAAHCMDGAESVTVYLGAINIG 88
            |.|.||....|...   .|:.:. |......|..||::...|:|||||.:.......::    ||
  Fly    33 PRIYNGIKTTVESL---GGVGIQLFNGRKLVCSATLLTPRHILTAAHCFENLNRSKFHV----IG 90

  Fly    89 DESEE----GQERIMVEKSGII---VHSNYMASTVVNDISLIRL-----PAFVGFTDRIRAASLP 141
            .:|.|    |..   ..|:.:|   :|..|.....:.|:::.:.     ..::|:....|:...|
  Fly    91 GKSAEFTWHGNN---FNKNKLIRVQIHPKYAKMKFIADVAVAKTKYPLRSKYIGYAQLCRSVLHP 152

  Fly   142 RRLNGQFPTYESIRAFASGWGRESDASD-SVSPVLRYVEMPIMPHSLCRMYWSGAVSEKMICMST 205
            |.           :..|:|||.|....| |.....|.:::.|:....|.......:...:||...
  Fly   153 RD-----------KLIAAGWGFEGGVWDESRKKTFRSMKVGIVSKRDCEKQLDRKMPPNIICAGA 206

  Fly   206 TSGKSTCHGDSGGPLV------------YKQGNS 227
            .:.|:.|.|||||||:            :|.||:
  Fly   207 YNNKTLCFGDSGGPLLLGRQVCGINTWTFKCGNN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 53/227 (23%)
Tryp_SPc 27..260 CDD:214473 53/227 (23%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 48/210 (23%)
Trypsin 49..256 CDD:278516 48/210 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471119
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.