DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG10232

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:288 Identity:76/288 - (26%)
Similarity:113/288 - (39%) Gaps:63/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLVGSCTAVPLLTDVEPY-ITNGEPAEVGQFPYQAGL---NVSFGNWSTWCGGTLISHYWIITAA 69
            :|..||...|.|     | :..|..|...::|:.|.|   |......:..|.|:||:..:::|||
  Fly   243 VLPTSCGQAPPL-----YRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAA 302

  Fly    70 HCM--DGAESVTVYLGAINIGDES------------------EEGQERIMVEKSGIIVHSNYM-A 113
            ||:  |...:..:.|..:.:|:..                  |.|.|...       ||..|. .
  Fly   303 HCVVKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFN-------VHEQYFNT 360

  Fly   114 STVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYV 178
            |...:||:|:||...|.:|..|....:|:   ...|.:......| |||...:...|        
  Fly   361 SRFESDIALVRLQTPVRYTHEILPICVPK---DPIPLHNHPLQIA-GWGYTKNREYS-------- 413

  Fly   179 EMPIMPHSLC---RMYWSGAVS----EKMICMSTTSGKSTCHGDSGGPLVYKQGNS----SYLIG 232
              .::.|:..   |.|....:|    |..||.|...|:.:|.|||||||:....|.    .||.|
  Fly   414 --QVLLHNTVYENRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAG 476

  Fly   233 STSFGTSMGCQVGFPAVFTRISSYLDWI 260
            ..|:| |..|....|.|:|:..::..||
  Fly   477 IVSYG-SENCGDRKPGVYTKTGAFFSWI 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 70/269 (26%)
Tryp_SPc 27..260 CDD:214473 68/267 (25%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 70/266 (26%)
Tryp_SPc 260..503 CDD:214473 68/264 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436319
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.