DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG16710

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:295 Identity:84/295 - (28%)
Similarity:131/295 - (44%) Gaps:46/295 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLLVCV-----LLVGSCTAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWSTW-------C 55
            ::|:|.     :|..:....|::....  |..||..:..:.|:.|.:..:..:.|.|       |
  Fly    79 RVLICCPNMGHILPNTQICGPIMPAYR--IFGGEETQPNELPWMALILYAHRSRSVWNERLVSRC 141

  Fly    56 GGTLISHYWIITAAHCM--DGAESVTVYLGAINIGDESE-----EGQERIMVEKSGI-----IVH 108
            .|:||::.:::|||||:  .|.:...|.||..||....:     .|:|....|...|     |.|
  Fly   142 AGSLITNRYVLTAAHCLRITGLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKH 206

  Fly   109 SNYMA--STVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSV 171
            .:||.  ....|||:|:||...|.:|.:|:...:........|::.:.:...:|||.......|.
  Fly   207 RHYMVFEERPYNDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQGYSN 271

  Fly   172 SPVLRYV------EMPIMPHSLCRMYWSGAVSEKMICMSTTSGKSTCHGDSGGPL--VYKQGNSS 228
            ..:..||      |..:...||      |...|..||.....|..||.|||||||  :.::|:..
  Fly   272 VLLQAYVNGRNADECSLSEPSL------GLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEE 330

  Fly   229 --YLIGSTSFGTSMGCQVGFPAVFTRISSYLDWIL 261
              ||.|.||:|.|. |..| ||.:|:.|.:::|||
  Fly   331 FVYLAGITSYGYSQ-CGYG-PAAYTKTSKFVEWIL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 80/266 (30%)
Tryp_SPc 27..260 CDD:214473 77/263 (29%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 1/4 (25%)
Tryp_SPc 105..362 CDD:214473 77/266 (29%)
Tryp_SPc 106..362 CDD:238113 77/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436320
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.