DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG31219

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:264 Identity:77/264 - (29%)
Similarity:123/264 - (46%) Gaps:43/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ITNGEPAEVGQFPYQAGLNVSFGNWST-----WCGGTLISHYWIITAAHCMDG------------ 74
            :..|..|....:|:.|.|  .:.|.:|     :|.|:||::.:::|:|||::|            
  Fly    89 MVGGSEARPNGYPWMAML--LYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRL 151

  Fly    75 AESVTVYLGAINIGDESEEGQ-----ERIMVEKSGIIVHSNYMASTVVN-----DISLIRLPAFV 129
            .|....|..|.|.....::.|     ..|.:||  ||||.  :.|::.|     ||:|:||...|
  Fly   152 GEHDITYDPAYNPDCRDQDNQCALPNLEIKLEK--IIVHG--LFSSISNRNIEYDIALLRLKMPV 212

  Fly   130 GFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLC--RMYW 192
            .:...|....:|:  :|.|   ...:...:|||:.::.  ..|.||.:..:.....::|  |..:
  Fly   213 RYRTGIMPICIPK--HGFF---AKSKLEIAGWGKTNEG--QFSQVLMHGFIRERSIAVCALRFPY 270

  Fly   193 SGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSS-YLIGSTSFGTSMGCQVGFPAVFTRISSY 256
            ........||.....|..||.|||||||:....||| ||.|.|::|:....|:|.|.::||.|::
  Fly   271 LDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAF 335

  Fly   257 LDWI 260
            |.||
  Fly   336 LPWI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 77/264 (29%)
Tryp_SPc 27..260 CDD:214473 75/262 (29%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 75/262 (29%)
Tryp_SPc 90..342 CDD:238113 77/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436318
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.