DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG17475

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:288 Identity:83/288 - (28%)
Similarity:126/288 - (43%) Gaps:46/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMKLLVCVLLVGSC----TAVPLL---------------TDVEPYITNGEPAEVGQFPYQAGLNV 46
            ::::|| :||..:|    :||.|.               .:.:..:.|||..::|:..||..|..
  Fly     6 VVQILV-ILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQG 69

  Fly    47 SFGNWSTWCGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNY 111
            .:|...  |||.:|....::|||||:.|..  ..||..|....|.|:......||:..|  |.||
  Fly    70 MYGGHI--CGGCIIDERHVLTAAHCVYGYN--PTYLRVITGTVEYEKPDAVYFVEEHWI--HCNY 128

  Fly   112 MASTVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRE---SDASDSVSP 173
            .:....|||:||||...:.|.:..:.|.||..     |.....:...:|||..   .|..|    
  Fly   129 NSPDYHNDIALIRLNDTIKFNEYTQPAELPTA-----PVANGTQLLLTGWGSTELWGDTPD---- 184

  Fly   174 VLRYVEMPIMPHSLCRMYWSGAVSEK--MICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSF 236
            :|:...:..:.:|.|:...:...|..  .||..||.|:..|||||||||.:    :..|.|..::
  Fly   185 ILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTH----NGVLYGLVNW 245

  Fly   237 GTSMGCQVGFPAVFTRISSYLDWILNHI 264
            |  ..|.:|.|.....:..||:||.:.|
  Fly   246 G--YPCALGVPDSHANVYYYLEWIRSMI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 74/240 (31%)
Tryp_SPc 27..260 CDD:214473 72/237 (30%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 72/238 (30%)
Tryp_SPc 50..269 CDD:238113 74/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436882
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.