DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG31265

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:286 Identity:85/286 - (29%)
Similarity:127/286 - (44%) Gaps:41/286 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKLLVCVLLV-------GSCTAVPLLTDVEPY-------ITNGEPAEVGQFPYQAGLNVSFGNWS 52
            ||||...||:       ..|.:..:   |.|:       |..||.||:|..|||..|....|:.:
  Fly     1 MKLLRLSLLILLAVKPPNPCESKRI---VGPFPAGQSGRIKGGEEAEIGFAPYQVSLQPIVGSHN 62

  Fly    53 TWCGGTLISHYWIITAAHCMDG--AESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMAST 115
              |||.:::..|||||.||::.  ...|.|..|.   ...:|.|......|   |..|..|....
  Fly    63 --CGGAILNENWIITAGHCVENFIPALVNVITGT---NKWAEPGAIYYTAE---IHKHCMYDQPY 119

  Fly   116 VVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEM 180
            :.|||:|::|...:.|.:..:..:||.|     |.........:|||.:.....|:.. |..:.:
  Fly   120 MHNDIALVKLTENITFNELTQPIALPTR-----PVQLGEEIVLTGWGSDVAYGSSMED-LHKLTV 178

  Fly   181 PIMPHSLCRMYWSGAVSEKM--ICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQ 243
            .::|...|...::...|..:  ||..:..|:..||||||||||    ::..|:|..::|..  |.
  Fly   179 GLVPLDECYETFNRTSSMGVGHICTFSREGEGACHGDSGGPLV----SNGQLVGVVNWGRP--CG 237

  Fly   244 VGFPAVFTRISSYLDWILNHIIAHNK 269
            ||.|.|...:..|||||.:.:..:||
  Fly   238 VGLPDVQANVYYYLDWIRSKLSGNNK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 74/239 (31%)
Tryp_SPc 27..260 CDD:214473 72/236 (31%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 72/237 (30%)
Tryp_SPc 39..257 CDD:238113 73/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.