DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and modSP

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:282 Identity:64/282 - (22%)
Similarity:103/282 - (36%) Gaps:62/282 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWST------WCGGTLISHYWIITAAHCM--DGA 75
            |.|.::.:.:.|........|:..||.|    |..      .|||:|::...:||||||:  :|.
  Fly   361 LATPIKQFSSGGYTINNTVVPWHVGLYV----WHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGT 421

  Fly    76 ESVTVY-----LGA---INIGDESEEGQERIMVEKSGIIVHSNYMAST--VVNDISLIRL----- 125
            .....|     :.|   .|.|:.:.|.:.|   :...|.:...|...|  ...|::|:.|     
  Fly   422 RLPYSYDTFRVIAAKFYRNYGETTPEEKRR---DVRLIEIAPGYKGRTENYYQDLALLTLDEPFE 483

  Fly   126 ------PAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMP 184
                  |..|.|.......|:...:.|:|          :||..|:...      |::|......
  Fly   484 LSHVIRPICVTFASFAEKESVTDDVQGKF----------AGWNIENKHE------LQFVPAVSKS 532

  Fly   185 HSLCRMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFP-- 247
            :|:||.......::| .|:.|......|.|||||....:...:::...:|:.....|.....|  
  Fly   533 NSVCRRNLRDIQADK-FCIFTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGVISNAPNA 596

  Fly   248 -------AVFTRISSYLDWILN 262
                   .|.|.|..:.|.|||
  Fly   597 DQCAHSLTVMTNIQHFEDMILN 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 62/274 (23%)
Tryp_SPc 27..260 CDD:214473 59/270 (22%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 59/268 (22%)
Tryp_SPc 371..591 CDD:304450 54/243 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436878
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.