DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG3505

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:262 Identity:71/262 - (27%)
Similarity:120/262 - (45%) Gaps:44/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TNGEPAEVGQFPYQAGLNVSFGNWST--WCGGTLISHYWIITAAHCMDGAESVTVYLGAINIGD- 89
            :|.....:.:||:.|.:..:.||...  .|||.|||..:::|||||:..|.:..:.:.|:.:|: 
  Fly   108 SNDTDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEW 172

  Fly    90 -----------------ESEEGQERIMVEKSGIIVHSNYMAS--TVVNDISLIRLPAFVGFTDRI 135
                             :.....:.|.:|:  ::.|..|..:  |.:|||:|:||.:.....|.:
  Fly   173 DTSTNPDCQYHEDSKVADCAPPYQDIAIEE--LLPHPLYNRTDRTQINDIALVRLASPAKLNDFV 235

  Fly   136 RAASLPRRLNGQF--PTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSG---A 195
            :...||   |.|.  ...|.:....:||    .||.|......||.:..:..  |:..::.   .
  Fly   236 QPICLP---NKQLRADELEDLVTEVAGW----QASSSQRMRKGYVTISSIEE--CQRKYASQQLR 291

  Fly   196 VSEKMICMSTTSGKSTCHGDSGGPL-VYKQGNSSYLIGS-TSFGTSMGCQVGFPAVFTRISSYLD 258
            :....:|..|.|  ..|:|::|||| ::|  |..||:|. .|||........:|.|:||::||:|
  Fly   292 IQASKLCGLTNS--QECYGNAGGPLMLFK--NDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYID 352

  Fly   259 WI 260
            ||
  Fly   353 WI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 71/262 (27%)
Tryp_SPc 27..260 CDD:214473 69/260 (27%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 70/259 (27%)
Tryp_SPc 111..354 CDD:214473 68/257 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436323
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.