DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG31326

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:264 Identity:68/264 - (25%)
Similarity:116/264 - (43%) Gaps:49/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PYITNGEPAEVGQFPYQAGL---NVSFGNWSTWCGGTLISHYWIITAAHCMDG------AESVTV 80
            |.|..|:..:.||.|:...:   ..|.|. :..|||||||...:::||||...      |..:.|
  Fly   272 PLIFQGKSLQRGQLPWLVAIFERRESNGP-AFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAV 335

  Fly    81 YLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVN-DISLIRLPAFVGFTDRIRAASLPRRL 144
            .||...:...| :|:.|.:   |.:|:|.|:....... |::|:||...|.:||.|....|....
  Fly   336 SLGRNTLAIHS-DGEFRGV---SQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTS 396

  Fly   145 NGQFPTYESIRAFASGWGRESDASDS-----------VSPVLRYVEMP---IMPHSLCRMYWSGA 195
            | :....:.::::.:|||.:...:.:           ||.....:|:|   :.|.|||       
  Fly   397 N-RMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQPSSLC------- 453

  Fly   196 VSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGT----SMGCQVGFPAVFTRISSY 256
                    :..:|...|..|.||||:.::.:...|.|..|.|.    ...|::..|:|||.::.:
  Fly   454 --------AKKTGAGPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKH 510

  Fly   257 LDWI 260
            ::|:
  Fly   511 IEWV 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 67/262 (26%)
Tryp_SPc 27..260 CDD:214473 66/260 (25%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 66/259 (25%)
Tryp_SPc 277..514 CDD:214473 65/257 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471148
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.