DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG9649

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:264 Identity:71/264 - (26%)
Similarity:121/264 - (45%) Gaps:44/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PYITNGEPAEVGQFPYQAGLNVSFG-NWSTWCGGTLISHYWIITAAHCMDGAESVTVYLGAINIG 88
            |:|.||...|.||.|:.|.|....| :::..|||||||...:|:||||.        ..|:.|:.
  Fly   255 PFIHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHCF--------RFGSRNLP 311

  Fly    89 DES---EEGQERIMVEKSG-------IIVHSNYMASTVVN-DISLIRLPAFVGFTDRIRAASLPR 142
            .|.   ..|:..:.:..||       :::|..|..:...: |::|::|...|...|.|:...|  
  Fly   312 GERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKPICL-- 374

  Fly   143 RLNGQF----PTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGAVSEK---- 199
             .|..|    |:  ..:::.:||| |.:..:..:.:.:..:..|:....||    |.:||:    
  Fly   375 -WNENFLLELPS--GHKSYVAGWG-EDEKGNRNTRLAKMTDTDIITQWECR----GNLSEENAKF 431

  Fly   200 ----MICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSM--GCQVGFPAVFTRISSYLD 258
                .||.|.......|.|||||.|:.::.:...|.|..|.|..|  .|.:..|.::|.::.:::
  Fly   432 ITSHTICASNAQASGPCSGDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIE 496

  Fly   259 WILN 262
            |:|:
  Fly   497 WLLS 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 70/262 (27%)
Tryp_SPc 27..260 CDD:214473 68/258 (26%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 68/258 (26%)
Tryp_SPc 259..497 CDD:214473 67/255 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471090
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.