DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and snk

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:255 Identity:82/255 - (32%)
Similarity:128/255 - (50%) Gaps:30/255 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PYITNGEPAEVGQFPYQAGLNVSFGNWS-----TW-CGGTLISHYWIITAAHCMDGAESV--TVY 81
            |.|..|.|...|.||:.|.|..:.|:.|     .| |||.|:|..:::|||||.......  .|.
  Fly   184 PLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVR 248

  Fly    82 LGAINIGDESEEGQE-RIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLPRRLN 145
            |||..:.:.|...|: :|::    |::|..|.:|...:||:|::|...|.|::::|.|.|.:...
  Fly   249 LGARQLNETSATQQDIKILI----IVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPE 309

  Fly   146 GQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYW-------SGAVSEKMICM 203
            .|.||     ..|:|||| ::...:.|..||.|::.::|...|:..:       .|.:..:....
  Fly   310 LQIPT-----VVAAGWGR-TEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAG 368

  Fly   204 STTSGKSTCHGDSGGP---LVYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWI 260
            ....|:.||.||||||   |:.:....::::|.||||...... ..|.|:||:.||||||
  Fly   369 YLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAP-NAPGVYTRLYSYLDWI 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 81/253 (32%)
Tryp_SPc 27..260 CDD:214473 79/251 (31%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 81/253 (32%)
Tryp_SPc 186..427 CDD:214473 79/251 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437044
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.