DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG14088

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:219 Identity:51/219 - (23%)
Similarity:87/219 - (39%) Gaps:29/219 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GTLISHYWIITAAHCMDGAESVTVYLGAI-NIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDI 120
            ||||...:|:|..||.|....:...||.. .||  ||..::.|:   :....::|:...|..|::
  Fly    60 GTLIHERFILTDVHCGDSIGVIRARLGEYGRIG--SELAEDHIV---AAFFSNANFNPETQANNM 119

  Fly   121 SLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASG--WGRESDASDSVSPVLRYVEMPIM 183
            .|::|...|.:.:.|....:  .::.:..|:.....:.:|  | :.||.    ||:||...:..|
  Fly   120 GLMKLLRTVVYKEHIIPVCI--LMDSRMQTFADELDYFNGTTW-KNSDK----SPMLRSKTVIRM 177

  Fly   184 PHSLCRMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLV----YKQGNSSYLIGSTSFGTSMGCQV 244
            |.: |     |.:.....| :......:|...||..|.    |...|.:.|.|   ...|:..:.
  Fly   178 PQA-C-----GKLDHGQFC-AGHKDLDSCDEPSGAALTREIDYIGPNRTVLFG---IANSVEVKC 232

  Fly   245 GFPAVFTRISSYLDWILNHIIAHN 268
            .....:|.:.....||...|.:.|
  Fly   233 SNSRTYTDVVQLHQWISMVIYSSN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 49/212 (23%)
Tryp_SPc 27..260 CDD:214473 47/209 (22%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 49/212 (23%)
Tryp_SPc 42..248 CDD:214473 47/209 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.