DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG11529

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:255 Identity:88/255 - (34%)
Similarity:135/255 - (52%) Gaps:19/255 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TDVEPY-ITNGEPAEVGQFPYQAGLNVSFGNWSTW-----CGGTLISHYWIITAAHCMDGAESVT 79
            |..:.| :...:...:.:||||..|   .|. ..|     |||||:...||:||.||..|.....
  Fly    23 TPTDSYAVGQSKYGRIEKFPYQVML---IGK-QLWRKRILCGGTLLDKRWILTAGHCTMGVTHYD 83

  Fly    80 VYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLPRRL 144
            ||||..::.|....|  .:::..:..|||..:...|..|||:|::||..|.||.||:.||||.|.
  Fly    84 VYLGTKSVEDTEVSG--GLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRY 146

  Fly   145 NGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGAVSEKMICMSTTSGK 209
              :...:..:...|||||...:.::|.|  ::|.|:.::.::.|...:. .|:..:||......:
  Fly   147 --RHDQFAGMSVVASGWGAMVEMTNSDS--MQYTELKVISNAECAQEYD-VVTSGVICAKGLKDE 206

  Fly   210 STCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWILNHIIAHNK 269
            :.|.||||||||.|  ::..::|.||||.:.||:...|..|||::.|||||.:.|.:|.:
  Fly   207 TVCTGDSGGPLVLK--DTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIESKIGSHGQ 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 84/240 (35%)
Tryp_SPc 27..260 CDD:214473 82/237 (35%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 84/233 (36%)
Tryp_SPc 37..255 CDD:214473 82/230 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
88.070

Return to query results.
Submit another query.