DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG18180

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:271 Identity:94/271 - (34%)
Similarity:138/271 - (50%) Gaps:27/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKLLV------CVLLVGSCTAVPLLT----DVEPYITNGEPAEVGQFPYQAGLNV-SFGNWSTWC 55
            |||.:      ..|:..|.|.:...|    ..|..|.||.||..|:.||..||.: :.|:.|...
  Fly     1 MKLFLLTLSAALALVAASPTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGAV 65

  Fly    56 G-GTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVND 119
            | ||:|::.||:|||||:.| :.|.::.|: |.|   ..|..|..|.:...|.|.:: .|....|
  Fly    66 GAGTIIANDWILTAAHCLTG-DYVEIHYGS-NWG---WNGAYRQTVRRDNFISHPDW-PSQGGRD 124

  Fly   120 ISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMP 184
            |.|||.| .|.|...|....|| .:|.|...|:.....|.|||...:.  :::..|:.|::.|:.
  Fly   125 IGLIRTP-HVDFNGLINKIPLP-SMNEQNDRYQDTWCVACGWGGMDNG--NLADWLQCVDVQIIS 185

  Fly   185 HSLCRMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAV 249
            :|.|...: |:|:...:|.....|||.|.||||||||  ..:::.|:|..:| .|:.|..| |:.
  Fly   186 NSECEQAY-GSVASTDMCTRHADGKSVCGGDSGGPLV--THDNARLVGVITF-ASVSCHDG-PSG 245

  Fly   250 FTRISSYLDWI 260
            :||:|.||:||
  Fly   246 YTRVSDYLEWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 86/236 (36%)
Tryp_SPc 27..260 CDD:214473 84/234 (36%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 84/235 (36%)
Tryp_SPc 36..259 CDD:238113 86/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470921
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.