DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG18179

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:275 Identity:94/275 - (34%)
Similarity:141/275 - (51%) Gaps:31/275 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKLLVCVLLV-----------GSCTAVPLLT---DVEPYITNGEPAEVGQFPYQAGLNV-SFGNW 51
            |||.:..|.|           ...:.:|.:|   ..|..|.||.||..|:.||..||.: :.|:.
  Fly     1 MKLFLLTLSVALAVVAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSN 65

  Fly    52 STWCG-GTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMAST 115
            |...| ||:|:..||:|||||:. .:.|.::.|: |.|   ..|..|..|.:...|.|.|:.|..
  Fly    66 SAAVGAGTIIASDWILTAAHCLT-TDYVEIHYGS-NWG---WNGAFRQSVRRDNFISHPNWPAEG 125

  Fly   116 VVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEM 180
             ..||.|||.|: |||||.|...:|| ..:.:...:......|.|||...:.  :::..|:.:::
  Fly   126 -GRDIGLIRTPS-VGFTDLINKVALP-SFSEESDRFVDTWCVACGWGGMDNG--NLADWLQCMDV 185

  Fly   181 PIMPHSLCRMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVG 245
            .|:.:|.|...: |.|:...:|...|.|||:|.||||||||  ..:::.|:|..:|| |:.|..|
  Fly   186 QIISNSECEQSY-GTVASTDMCTRRTDGKSSCGGDSGGPLV--THDNARLVGVITFG-SVDCHSG 246

  Fly   246 FPAVFTRISSYLDWI 260
             |:.:||::.||.||
  Fly   247 -PSGYTRVTDYLGWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 86/236 (36%)
Tryp_SPc 27..260 CDD:214473 84/234 (36%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 84/235 (36%)
Tryp_SPc 40..263 CDD:238113 86/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470925
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.