DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG8329

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:235 Identity:82/235 - (34%)
Similarity:132/235 - (56%) Gaps:20/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDES 91
            |.||.||..|:.||..||.::.|...   ||::|.:.|::|||||:. .:|||::.|:    :.:
  Fly    35 IVNGYPAYEGKAPYAVGLRMNNGAVG---GGSVIGNNWVLTAAHCLT-TDSVTIHYGS----NRA 91

  Fly    92 EEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRA 156
            ..||.:..|.|:....|..| .::..:||.|||.| :|.||:.|...||| :.:.:...:|:...
  Fly    92 WNGQLQHTVNKNNFFRHPGY-PNSAGHDIGLIRTP-YVSFTNLINKVSLP-KFSQKGERFENWWC 153

  Fly   157 FASGWGRESDASDSVSPVLRYVEMPIMPHSLC-RMYWSGAVSEKMICMSTTSGKSTCHGDSGGPL 220
            .|.|||  ..|:..::..|:.:::.::.:..| |.|  |:|:...:|...|.|||.|.|||||.|
  Fly   154 VACGWG--GMANGGLADWLQCMDVQVISNGECARSY--GSVASTDMCTRATDGKSVCGGDSGGAL 214

  Fly   221 VYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWI 260
            |  ..::...:|..:| .|:||:.| |:.:||:|.:||||
  Fly   215 V--THDNPIQVGVITF-ASIGCKSG-PSGYTRVSDHLDWI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 82/235 (35%)
Tryp_SPc 27..260 CDD:214473 80/233 (34%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 82/235 (35%)
Tryp_SPc 35..250 CDD:214473 80/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470923
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.