DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG3088

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:263 Identity:100/263 - (38%)
Similarity:149/263 - (56%) Gaps:23/263 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKLLVCVL---LVGSCTAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHY 63
            |||||..|   ||.:.:|.....|.:..||||.||..||.||..|:  :||..:.||.||:|...
  Fly     1 MKLLVVFLGLTLVAAGSAKKDSEDPDHIITNGSPAYEGQAPYVVGM--AFGQSNIWCSGTIIGDT 63

  Fly    64 WIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAF 128
            ||:|:|.|:.|:..||:|.||..:    .:.|..:.|..|..:..:.::|        |:|:|. 
  Fly    64 WILTSAQCLTGSSGVTIYFGATRL----SQAQFTVTVGTSEYVTGNQHLA--------LVRVPR- 115

  Fly   129 VGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLC-RMYW 192
            |||::|:...:|| .|..:...||:..|...||| .:..|:.::..|:.|::.||.::.| ..|.
  Fly   116 VGFSNRVNRVALP-SLRNRSQRYENWWANVCGWG-VTTFSNGLTDALQCVDLQIMSNNECIAFYG 178

  Fly   193 SGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYL 257
            |..||::::|..|.||:|||.||:|.||:.||  .|.::|.::|..|.||.:|.||.|.||:|.|
  Fly   179 STTVSDQILCTRTPSGRSTCFGDAGSPLITKQ--DSTVVGISAFVASNGCTLGLPAGFARITSAL 241

  Fly   258 DWI 260
            |||
  Fly   242 DWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 90/235 (38%)
Tryp_SPc 27..260 CDD:214473 88/233 (38%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 90/235 (38%)
Tryp_SPc 29..244 CDD:214473 88/233 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470926
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.