DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG10472

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:235 Identity:118/235 - (50%)
Similarity:156/235 - (66%) Gaps:3/235 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWIITAAHCMDG-AESVTVYLGAINIGDE 90
            ||.|:.||..|||||.||.:.....:.|||||:||..||||||||.|. ...|.|||||.:..:.
  Fly    47 ITGGQIAEPNQFPYQVGLLLYITGGAAWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNA 111

  Fly    91 SEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIR 155
            .||||:.|.||...:|||.:::|.|:.||||||:||..:.|...|:.|.||.: :..:.||....
  Fly   112 KEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVK-SDSYSTYGGEN 175

  Fly   156 AFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGAVSEKMICMSTTSGKSTCHGDSGGPL 220
            |.|||||:.||::...:.:|:|..:|||.:|.|..::.|.|:...||:.||.|.|||:|||||||
  Fly   176 AIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGPL 240

  Fly   221 VYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWI 260
            |...| |:.|||:||||.::||:||:|.|||||:.|||||
  Fly   241 VLDDG-SNTLIGATSFGIALGCEVGWPGVFTRITYYLDWI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 118/235 (50%)
Tryp_SPc 27..260 CDD:214473 116/233 (50%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 116/233 (50%)
Tryp_SPc 47..282 CDD:238113 118/235 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470917
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.