DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG6592

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:269 Identity:101/269 - (37%)
Similarity:155/269 - (57%) Gaps:12/269 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVGSCTAVPLLTDVEP-------YITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWIIT 67
            ||.:....||:..:.|       .|..|:......||||.|:.:.......||||:|||...:||
  Fly    99 LVLNLETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVIT 163

  Fly    68 AAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFT 132
            ||||:|.|:...|:|||..|.:..|:||.|:||......::..:....:.:||:::|||..|.|.
  Fly   164 AAHCVDMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFN 228

  Fly   133 DRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGAVS 197
            :||....||:| :.::.::::..|.||||||.:....::|.|||||::.|:....|:..:..:..
  Fly   229 ERIHPIQLPKR-HYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYR 292

  Fly   198 EKMICMSTTSGKSTCHGDSGGPLVYKQGNSS--YLIGSTSFGTSMGCQVGFPAVFTRISSYLDWI 260
            ...||.|..:.:|||:||||||||.::.:|.  .|:|.||||:..||..|:||.||:::||||||
  Fly   293 GTNICTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWI 357

  Fly   261 LNH--IIAH 267
            .:.  :.||
  Fly   358 SDETGVSAH 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 94/237 (40%)
Tryp_SPc 27..260 CDD:214473 92/234 (39%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 92/235 (39%)
Tryp_SPc 123..359 CDD:238113 94/236 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470948
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1010.000

Return to query results.
Submit another query.