DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG10477

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:251 Identity:107/251 - (42%)
Similarity:154/251 - (61%) Gaps:18/251 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TAVPLLTDVEPYITNGEPAEVGQFPYQAGLNV--SFGNWSTWCGGTLISHYWIITAAHCMDGAES 77
            :|||   .::..||||..|...|||||.||:.  |.|:|  ||||::|::.|::|||||..||.|
  Fly    31 SAVP---SIDGRITNGNKAAANQFPYQVGLSFKSSAGSW--WCGGSIIANTWVLTAAHCTKGASS 90

  Fly    78 VTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLPR 142
            ||:|.|:    ......:.:..|..|..:.|:.|.|:|:.||||||:.|: |.||..|...:|| 
  Fly    91 VTIYYGS----TVRTSAKLKKKVSSSKFVQHAGYNAATLRNDISLIKTPS-VTFTVSINKIALP- 149

  Fly   143 RLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLC-RMYWSGAVSEKMICMSTT 206
            .:...:.||....|.||||||.||:|.:|:..|:|.:..::.:::| :.:.|..|:..:||:.:.
  Fly   150 AIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVESI 214

  Fly   207 SGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWILN 262
            :.||||.|||||||..    ::.|||.|||.:|.||:...||.|||::||||||.|
  Fly   215 NKKSTCQGDSGGPLAL----NNRLIGVTSFVSSKGCEKNAPAGFTRVTSYLDWIKN 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 104/239 (44%)
Tryp_SPc 27..260 CDD:214473 101/235 (43%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 101/236 (43%)
Tryp_SPc 40..267 CDD:238113 104/239 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470927
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1111.010

Return to query results.
Submit another query.