DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG10764

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:286 Identity:83/286 - (29%)
Similarity:134/286 - (46%) Gaps:38/286 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKLLVCVLLVGSCT------------AVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWSTW 54
            |:.||.|.|:...|            ..|......|.|:.|:.|......:.|.:   |.:....
  Fly     1 MRSLVSVALLSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAI---FNSSDFQ 62

  Fly    55 CGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVND 119
            ||||:|...::::||||:.....:.|.|||.||   :|......::   .:.||.:::||...||
  Fly    63 CGGTIIHMRFVLSAAHCLVRGYDLYVRLGARNI---NEPAAVHTVI---NVFVHHDFIASEYRND 121

  Fly   120 ISLIRLPAFVGFTDRIR--AASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPI 182
            |.|::|...:.:|.|::  ...|...|.|.....::.||.  |||   :.:..:|.:|:.:.:..
  Fly   122 IGLLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRAL--GWG---NRNGKLSIMLQTIYLLH 181

  Fly   183 MPHSLCRMYWSGAVSEKMICMSTTSGKSTCHGDSGGPL---VYKQGNSSY--LIGSTSFGTSMGC 242
            :..:.|:...:..::.:.||..|.:| .||.|||||||   :....|.||  .:|..|||.....
  Fly   182 LKRNECKRKLNFNLNSRQICAGTKNG-DTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECR 245

  Fly   243 QVGFPAVFTRISSYLDWILNHIIAHN 268
            .||   |:|.::||:||| :..||.|
  Fly   246 GVG---VYTDVTSYVDWI-SSTIARN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 72/242 (30%)
Tryp_SPc 27..260 CDD:214473 70/239 (29%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 70/240 (29%)
Tryp_SPc 38..263 CDD:238113 72/243 (30%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436344
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.