DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Prss48

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:286 Identity:81/286 - (28%)
Similarity:133/286 - (46%) Gaps:47/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKLLVCVLL---VGSCTAVPLLTDV--EPY----ITNGEPAEVGQFPYQAGLNVSFGNWSTWCGG 57
            :|:|:.:.|   .||.|....|..|  .|.    |..|:.|.:|::|:|..|..   :::..|||
Mouse     6 LKVLLLLFLGAFQGSFTKKKNLQSVCGRPVHTGRIVGGQDAALGRWPWQVSLRF---DYTHSCGG 67

  Fly    58 TLISHYWIITAAHCMDG---AESVTVYLGAINIGDESEEGQE----RIMVEKSGIIVHSNYMAST 115
            :|||.:|::|||||:..   :...:|:||:|: .:.|..|:|    ||.:...    |.:..|  
Mouse    68 SLISDHWVLTAAHCIKKTWYSFLYSVWLGSID-REYSSTGKEYYVSRIAIPDK----HRHTEA-- 125

  Fly   116 VVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEM 180
               ||:|::|.:.|.|:..|....|| .::.|.....|  .:.:|||:..:.  .....|:.:|:
Mouse   126 ---DIALLKLSSRVTFSSVILPICLP-NISKQLTVPAS--CWVTGWGQNQEG--HYPSTLQELEV 182

  Fly   181 PIMPHSLCRMYWS----------GAVSEKMICM-STTSGKSTCHGDSGGPLVYKQGNSSYLIGST 234
            |::....|...::          ..:.|.|.|. ...|.|.:|.|||||||.........|:|..
Mouse   183 PVISSEACEQLYNPIGVFLPDLERVIKEDMFCAGERQSRKDSCKGDSGGPLSCHIDGVWRLMGVV 247

  Fly   235 SFGTSMGCQVGFPAVFTRISSYLDWI 260
            |:|  :.|....|.|:|.::.|..||
Mouse   248 SWG--LECGKDLPGVYTNVTYYQKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 72/252 (29%)
Tryp_SPc 27..260 CDD:214473 70/250 (28%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 70/251 (28%)
Tryp_SPc 40..274 CDD:238113 72/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.