DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Ctrc

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001071117.1 Gene:Ctrc / 362653 RGDID:1308379 Length:268 Species:Rattus norvegicus


Alignment Length:266 Identity:88/266 - (33%)
Similarity:133/266 - (50%) Gaps:18/266 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLVCVLLVGSCTAVPLL-TDVEPYITNGEPAEVGQFPYQAGLN-VSFGNWSTWCGGTLISHYWII 66
            :|..:|...||...|.. .::...:..||.|....:|:|..|. :....|...|||:||:...::
  Rat     6 VLAAILACASCCGNPAFPPNLSTRVVGGEDAVPNSWPWQVSLQYLKDDTWRHTCGGSLITTSHVL 70

  Fly    67 TAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGF 131
            |||||::...:..|.||..|:..|.|||.  :..|...|.||..:....:.|||::|:|...|..
  Rat    71 TAAHCINKDFTYRVGLGKYNLTVEDEEGS--VYAEVDTIYVHEKWNRLFLWNDIAIIKLAEPVEL 133

  Fly   132 TDRIRAASLPRR---LNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRM--Y 191
            ::.|:.|.:|..   |...:|.|      .:|||| ...:..::.||:....||:.|:.|..  :
  Rat   134 SNTIQVACIPEEGSLLPQDYPCY------VTGWGR-LWTNGPIAEVLQQGLQPIVSHATCSRLDW 191

  Fly   192 WSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLI-GSTSFGTSMGCQV-GFPAVFTRIS 254
            |...|.:.|:|.......|.|:|||||||..:..:.|:.: |..|||:|.||.| ..|.||||:|
  Rat   192 WFIKVRKTMVCAGGDGVISACNGDSGGPLNCQAEDGSWQVHGIVSFGSSSGCNVHKKPVVFTRVS 256

  Fly   255 SYLDWI 260
            :|.|||
  Rat   257 AYNDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 83/242 (34%)
Tryp_SPc 27..260 CDD:214473 81/240 (34%)
CtrcNP_001071117.1 Tryp_SPc 29..262 CDD:214473 81/241 (34%)
Tryp_SPc 30..265 CDD:238113 83/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.