DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and PRSS41

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:273 Identity:75/273 - (27%)
Similarity:123/273 - (45%) Gaps:49/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DVEPYITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWIITAAHCMDG---AESVTVYLG 83
            ::...:..|..:..|::|:||.|.:...:   .|||:|:|..|:::||||...   ....||.||
Human    66 EIHALVAGGVESARGRWPWQASLRLRRRH---RCGGSLLSRRWVLSAAHCFQKHYYPSEWTVQLG 127

  Fly    84 AI-------NIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLP 141
            .:       |:...|    .|..|:  .|||:.:.: ..:.|||:|:||.:.|.:...|:...: 
Human   128 ELTSRPTPWNLRAYS----SRYKVQ--DIIVNPDAL-GVLRNDIALLRLASSVTYNAYIQPICI- 184

  Fly   142 RRLNGQFPTYESIR---AFASGWGRESDASDSVSPV--LRYVEMPIMPHSLCR----------MY 191
                 :..|:..:.   .:.:|||..|.:...:.|.  ||..::.|:.::.|.          |.
Human   185 -----ESSTFNFVHRPDCWVTGWGLISPSGTPLPPPYNLREAQVTILNNTRCNYLFEQPSSRSMI 244

  Fly   192 WSGAVSEKMICMSTTSGK-STCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISS 255
            |     :.|.|.....|. .||.||||||||..:....|.:|..|:|...| |...|.|:|.||.
Human   245 W-----DSMFCAGAEDGSVDTCKGDSGGPLVCDKDGLWYQVGIVSWGMDCG-QPNRPGVYTNISV 303

  Fly   256 YLDWILNHIIAHN 268
            |..|| ..:::|:
Human   304 YFHWI-RRVMSHS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 74/261 (28%)
Tryp_SPc 27..260 CDD:214473 72/258 (28%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.