DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and try-9

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:229 Identity:58/229 - (25%)
Similarity:85/229 - (37%) Gaps:64/229 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GTLISHYWIITAAH-----------CMDG--AESVTV-----YLGAINIG---DESEEGQERIMV 100
            |||:|.:.|:||||           |..|  .|:..|     ::..:|:.   .|..:|..|..:
 Worm    30 GTLVSPWHIVTAAHLIGISEDPLPDCDTGNLREAYFVRDYKNFVAFVNVTCAVPEMCKGLHRKDM 94

  Fly   101 EK----SGIIVHSNYMASTVV-----NDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRA 156
            .|    ..:.:...|:....:     |||::..|...:.|:..|..|.||     ..|....||.
 Worm    95 FKPLAIKSLYIRKGYVGDGCIDRESFNDIAVFELEEPIEFSKDIFPACLP-----SAPKIPRIRE 154

  Fly   157 FA---SGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGAVSE--------KMICMSTTSGKS 210
            ..   .|:||  |.||||          :....|..:|  ..|:|        .:.|.|..:...
 Worm   155 TGYKLFGYGR--DPSDSV----------LESGKLKSLY--SFVAECSDDFPYGGVYCTSAVNRGL 205

  Fly   211 TCHGDSGGPLVYKQG--NSSYLIGSTSFGTSMGC 242
            :|.||||..:|....  |...|:|..|.|  |.|
 Worm   206 SCDGDSGSGVVRTSDTRNVQVLVGVLSAG--MPC 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 58/229 (25%)
Tryp_SPc 27..260 CDD:214473 58/229 (25%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 57/227 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.