DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and scaf

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:276 Identity:62/276 - (22%)
Similarity:111/276 - (40%) Gaps:37/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GSCTAVPLLTDVEPYITNG---------EP-------AEVGQFPYQAGLNVSFGNWSTWCGGTLI 60
            |.|...|...|..|....|         :|       |...:.|:|| :.:...:.:..|||.:|
  Fly   392 GKCCRDPNYVDPWPVNLAGVCATRNKRTKPTGVKDLDANFAEIPWQA-MILRESSKTLICGGAII 455

  Fly    61 SHYWIITAAHCMDG--AESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLI 123
            ...:::::|.|::|  ...:.|..|...:|..:|....::...|: :.||.:|..||..:|:::|
  Fly   456 GDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLPFQLTGVKT-VDVHPDYDPSTNSHDLAII 519

  Fly   124 RLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLC 188
            ||...:.|...|:    |..::.:.|. :|.:.|.||||:::.:......::...:......|.|
  Fly   520 RLERRLEFASHIQ----PICISDEDPK-DSEQCFTSGWGKQALSIHEEGALMHVTDTLPQARSEC 579

  Fly   189 RMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRI 253
                  :.....:|.:|..  .:|..|.|..|....|:|..|.|  .|.....|..|....|.:.
  Fly   580 ------SADSSSVCSATKF--DSCQFDVGSALACGSGSSVRLKG--IFAGENSCGEGQTVRFAKP 634

  Fly   254 SSYLDWILNHIIAHNK 269
            .  :.||......:||
  Fly   635 D--IKWINTAFAENNK 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 55/253 (22%)
Tryp_SPc 27..260 CDD:214473 53/250 (21%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 47/204 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435404
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.