DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG17572

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:287 Identity:70/287 - (24%)
Similarity:126/287 - (43%) Gaps:51/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCVLLVGSCTAVPLLTD-------VEPYITNGEPAEVGQFPYQAGL---NVSFGNWSTWCGGTLI 60
            ||      |.:.||..:       |:.:...|    :|.:|:.|.:   :|:.|.::..|.|.:|
  Fly   111 VC------CPSSPLEKNQVCGKSLVQGHFYKG----LGSYPFVARIGFKHVNTGAFAYPCAGAVI 165

  Fly    61 SHYWIITAAHC----MDGAESVTVYLGAINIGDESEEGQERIMVEK------SGIIVHSNYMAST 115
            :...|:|||||    .||....:|.:|..:...:.:.........:      |.:|||.:|....
  Fly   166 ARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQ 230

  Fly   116 VVNDISLIRLPAFVGFTDRIRAASLPR-RLN---GQFPTYESIRAFASGWGRESDASDSVSPVLR 176
            ..:||:|:.|...:.::...:...|.: |.|   |:       ||..:|||:.|.:|.. .|.:.
  Fly   231 YHHDIALLVLKTPLNYSVATQPICLQKTRANLVVGK-------RATIAGWGKMSTSSVR-QPEMS 287

  Fly   177 YVEMPIMPHSLC-RMYWS-------GAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGS 233
            ::::|:....|| |.|.|       .::..:.:| :...||..|.|..|.||..::......||.
  Fly   288 HLDVPLTSWDLCLRNYGSTGALESPNSIEGQWMC-AGGEGKDVCQGFGGAPLFIQENGIFSQIGI 351

  Fly   234 TSFGTSMGCQVGFPAVFTRISSYLDWI 260
            .|||:.....:..|:|:|.::.:.:||
  Fly   352 MSFGSDNCGGLRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 64/259 (25%)
Tryp_SPc 27..260 CDD:214473 62/257 (24%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 63/250 (25%)
Tryp_SPc 138..378 CDD:214473 61/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.