DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG9377

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:260 Identity:60/260 - (23%)
Similarity:107/260 - (41%) Gaps:55/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWIITAAHCMDGAESVTVYL------GAINIGD 89
            :.|:.|:||:   |...:|:.:..|.|.||:...:||.|||:..:|...|.|      .|:.:  
  Fly   105 QEAKFGEFPW---LVAVYGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVEL-- 164

  Fly    90 ESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASL----------PRRL 144
            |.:..|:|.:||   .:||.||....:.::|:::       ..|:.:...|          |.|:
  Fly   165 EPQPHQQRSVVE---TLVHPNYTQMPLAHNIAIL-------LVDKEKPFQLAPNVQPICLPPPRI 219

  Fly   145 NGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCR-------MYWSGAVSEKMIC 202
                 .|...:.:.|||.|......::.|  :...:.::|...||       :....|.::.::|
  Fly   220 -----MYNYSQCYVSGWQRSDFGRAAILP--KRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLC 277

  Fly   203 MSTTSGKSTCHGD---SGGPLVYK-QGNSS--YLIG-STSFGTSMGCQVGFPAVFTRISSYLDWI 260
            .....|...| ||   :..||:.. .|:..  :|.| .|......|.|:  ..::|.:..|..||
  Fly   278 AGGDKGDFVC-GDVDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQL--LGIYTNVKLYRQWI 339

  Fly   261  260
              Fly   340  339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 60/260 (23%)
Tryp_SPc 27..260 CDD:214473 58/258 (22%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 60/260 (23%)
Tryp_SPc 105..339 CDD:214473 58/258 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435369
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.