DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:280 Identity:99/280 - (35%)
Similarity:142/280 - (50%) Gaps:44/280 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKLLVCVLLVGSCTAVPLLTDVEP-----------YITNGEPAEVGQFPYQAGLNVSFGNWSTWC 55
            ||:.|.:.|..:..:...:..|.|           .|.||.||..|:.||..||..| ||...||
  Fly     1 MKVFVVLALALAAVSAETVQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFS-GNGGWWC 64

  Fly    56 GGTLISHYWIITAAHCMDGAESVTVYLGAI---------NIGDESEEGQERIMVEKSGIIVHSNY 111
            ||::|:|.|::|||||.:||..||:|.||.         .:|              ||..:.::.
  Fly    65 GGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQFTHTVG--------------SGDFIQNHN 115

  Fly   112 MASTVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLR 176
            ..:...|||:|||.| .|.|...:....|| ..|.::..|::..|.|.|||..:  :.|....:.
  Fly   116 WPNQNGNDIALIRTP-HVDFWHMVNKVELP-SFNDRYNMYDNYWAVACGWGLTT--AGSQPDWME 176

  Fly   177 YVEMPIMPHSLC-RMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSM 240
            .|::.|:.:|.| |.|  |...:.::|:||:.|||||.||||||||...|..  |:|.||:.:..
  Fly   177 CVDLQIISNSECSRTY--GTQPDGILCVSTSGGKSTCSGDSGGPLVLHDGGR--LVGVTSWVSGN 237

  Fly   241 GCQVGFPAVFTRISSYLDWI 260
            ||..|.|:.|||:::.||||
  Fly   238 GCTAGLPSGFTRVTNQLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 93/244 (38%)
Tryp_SPc 27..260 CDD:214473 91/242 (38%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 91/243 (37%)
Tryp_SPc 37..260 CDD:238113 93/244 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470916
Domainoid 1 1.000 182 1.000 Domainoid score I7153
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
99.000

Return to query results.
Submit another query.