DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Jon25Bii

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster


Alignment Length:280 Identity:116/280 - (41%)
Similarity:147/280 - (52%) Gaps:27/280 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKLLVCVLLVG-SCTA--------VPLLT--------DVEPYITNGEPAEVGQFPYQAGLNVSFG 49
            |||.:.||.|. :|.|        |||..        .:|..||||.||..|:.||..||..|..
  Fly     1 MKLFLTVLAVAIACAAAQPEKVKPVPLKDAVLGSGSGSIEGRITNGYPAYEGKVPYIVGLGFSSD 65

  Fly    50 NWSTWCGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMAS 114
            :...||||::|.|.|:||||||..||.|||:|.||:    ...:.|....|.......||:|..:
  Fly    66 SGGWWCGGSIIGHTWVITAAHCTHGAHSVTIYYGAL----WRLQAQYTHTVGSGHFRQHSDYNTN 126

  Fly   115 TVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVE 179
            .:.||||||..| .|.|...|....||.. |.:..::....|.||||||..| |..||..|..|:
  Fly   127 NLNNDISLINTP-HVDFWHLINKVELPDG-NERHDSFAGWWALASGWGRPCD-SCGVSDYLNCVD 188

  Fly   180 MPIMPHSLC-RMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQ 243
            ..|:....| .:|.:..:::.:||.||..|||||.||||||||..  :.|.|:|.|||..:.||.
  Fly   189 SQIITRDECSSVYGTDVITDNVICTSTPGGKSTCAGDSGGPLVLH--DRSKLVGVTSFVAASGCT 251

  Fly   244 VGFPAVFTRISSYLDWILNH 263
            .|.|..|||::||||||.:|
  Fly   252 SGLPDGFTRVTSYLDWIRDH 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 103/236 (44%)
Tryp_SPc 27..260 CDD:214473 101/233 (43%)
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 101/234 (43%)
Tryp_SPc 43..271 CDD:238113 103/236 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470937
Domainoid 1 1.000 182 1.000 Domainoid score I7153
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1111.010

Return to query results.
Submit another query.