DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Hayan

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:273 Identity:81/273 - (29%)
Similarity:134/273 - (49%) Gaps:36/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VGSCTAV-----PLLTDVEPYITNGEPAEVGQFPYQAGLNV-SFGNWSTWCGGTLISHYWIITAA 69
            |.:|..:     ||..    :|.:||..:.|.:|:.|.:.. |||:.:..|||:||:..:::|||
  Fly   368 VAACEKIRSGGKPLTV----HILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAA 428

  Fly    70 HCMDGAESVT--VYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFT 132
            ||::..:|..  |.|||:|| :..|.|.:.|.|  ..:.:|.:|..|:...||::::|......:
  Fly   429 HCVNSDDSTPSFVRLGALNI-ENPEPGYQDINV--IDVQIHPDYSGSSKYYDIAILQLAEDAKES 490

  Fly   133 DRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLC--------- 188
            |.||.|.|....:.....|   :.|.:|||..:..:.:||.:|....:.::|...|         
  Fly   491 DVIRPACLYTDRSDPPANY---KYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPS 552

  Fly   189 --RMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYK----QGNSSYLIGSTSFGTSMGCQVGFP 247
              |....|.::.::........|..|.|||||||:.:    .|..| ::|..|.|  .||....|
  Fly   553 ANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYS-IVGVISSG--FGCATKTP 614

  Fly   248 AVFTRISSYLDWI 260
            .::||:||:||:|
  Fly   615 GLYTRVSSFLDYI 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 77/252 (31%)
Tryp_SPc 27..260 CDD:214473 76/250 (30%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 76/251 (30%)
Tryp_SPc 385..630 CDD:238113 77/252 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437046
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.