DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG31269

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:283 Identity:84/283 - (29%)
Similarity:132/283 - (46%) Gaps:34/283 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKLLVCVLLVG-----SCTAVPL---LTDVEPY----ITNGEPAEVGQFPYQAGLNVSFGNWSTW 54
            |..:|.::|:|     |.||:.:   .||...|    |..|:.||.|..|||..|....|..|  
  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHS-- 63

  Fly    55 CGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVND 119
            |||.:|:..:::|||||::.|  ...:|..:...::..:...|..::  .|.:|.||....:.||
  Fly    64 CGGAIINETFVLTAAHCVENA--FIPWLVVVTGTNKYNQPGGRYFLK--AIHIHCNYDNPEMHND 124

  Fly   120 ISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPV-LRYVEMPIM 183
            |:|:.|...:.:.:|.:...||     ..|.........:|||  |......||: |:.:.:..:
  Fly   125 IALLELVEPIAWDERTQPIPLP-----LVPMQPGDEVILTGWG--STVLWGTSPIDLQVLYLQYV 182

  Fly   184 PHSLCRMYWSGAVSEKM--ICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGF 246
            ||..|:...|......:  ||..:..|:..||||||||||    ::.||:|..::|  ..|..|.
  Fly   183 PHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLV----SNGYLVGLVNWG--WPCATGV 241

  Fly   247 PAVFTRISSYLDWILNHIIAHNK 269
            |.|...:..|.|||.|.:..::|
  Fly   242 PDVHASVYFYRDWIRNVMSGNSK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 72/238 (30%)
Tryp_SPc 27..260 CDD:214473 70/235 (30%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 70/236 (30%)
Tryp_SPc 38..258 CDD:238113 72/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.