DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and spirit

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:253 Identity:79/253 - (31%)
Similarity:124/253 - (49%) Gaps:42/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ITNGEPAEVGQFPYQAGLNVSFGNWST--------WCGGTLISHYWIITAAHCMD--GAESVTVY 81
            :..|.|....:||:.|.|     .|.:        .|||.||::.:::|||||.|  |.....|.
  Fly   132 VVGGMPTRPREFPFMAAL-----GWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVR 191

  Fly    82 LGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLPRRLNG 146
            ||..|:  ...||:: |.:.:  :|:|.:|.|||..|||:|:.|          ..|:.|.....
  Fly   192 LGGDNL--TLTEGED-ISIRR--VIIHPDYSASTAYNDIALLEL----------ETAAKPELKPT 241

  Fly   147 QFPTYESIR---AFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYW------SGAVSEKMIC 202
            ...|.:.:.   ..|.|:|:.|.|..|.:.:|: |.:..:.:..|:.::      .|.:..:|..
  Fly   242 CIWTQKEVTNTLVTAIGYGQTSFAGLSSAQLLK-VPLKSVSNEECQHHYQKDQLAQGVLGTQMCA 305

  Fly   203 MSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWI 260
            ...|..:.||.|||||||:.:.|...|::|.||.|  .||..|.|:|:||:||::|||
  Fly   306 GDITGERDTCQGDSGGPLLMQDGLLGYVVGITSLG--QGCASGPPSVYTRVSSFVDWI 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 79/253 (31%)
Tryp_SPc 27..260 CDD:214473 77/251 (31%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 79/253 (31%)
Tryp_SPc 132..361 CDD:214473 77/251 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437043
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.