DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG11664

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:229 Identity:58/229 - (25%)
Similarity:96/229 - (41%) Gaps:45/229 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GTLISHYWIITAAHCM---DGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVN 118
            |:|.|..:::|.|||.   ...|.::|..|...|..|....|      .:|::.|..:...|:.|
  Fly    49 GSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGKQ------VAGLLRHPKFSPLTLRN 107

  Fly   119 DISLIRLPAFVGFTDRIRAASLPRR----LNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVE 179
            ||:::|:.|.:..:..|....|..|    ||...|..|     .:||...     .::..|:.:.
  Fly   108 DIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQE-----LAGWNLM-----HIAQPLKSMS 162

  Fly   180 MPIMPHSLCRMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQV 244
            :.:.|...||. |...:|..:||.|.|.|:..|:||||.||:             |.|...|..:
  Fly   163 VQVEPEKNCRQ-WFPQISGGVICASATMGEGLCYGDSGDPLI-------------SGGEVCGLAI 213

  Fly   245 GF--------PAVFTRISSYLDWILNHIIAHNKE 270
            .|        ||:||.:..:..:|...::..::|
  Fly   214 AFRKCGDKRYPALFTDVHYHRAFIAQAVLTLDRE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 57/220 (26%)
Tryp_SPc 27..260 CDD:214473 56/217 (26%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 57/219 (26%)
Tryp_SPc 38..237 CDD:214473 56/217 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.