DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Prss30

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:268 Identity:83/268 - (30%)
Similarity:126/268 - (47%) Gaps:51/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ITNGEPAEVGQFPYQAGLNVSFGNWST----WCGGTLISHYWIITAAHCMDGAESVTVY---LGA 84
            |..|:.|..||:|:|..|      |.|    .|||:||...|::|||||...:.:.:.|   :|.
Mouse    74 IVGGQDALEGQWPWQVSL------WITEDGHICGGSLIHEVWVLTAAHCFRRSLNPSFYHVKVGG 132

  Fly    85 INIGDESEEGQERIMVEKSGIIVHSNYM-ASTVVNDISLIRL-----PAFVGFTDRIRAASLPRR 143
            :.:   |.......:|....|.||..|: |.....||:|::|     |:      :.....||. 
Mouse   133 LTL---SLLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLDTPLRPS------QFTPVCLPA- 187

  Fly   144 LNGQFPTYESIRAFASGWG--RESDASDSVSPVLRYVEMPIMPHSLC-RMY------WSG--AVS 197
              .|.|.......:.:|||  :|.|    ::.||:.:.:|::....| :||      .||  .:.
Mouse   188 --AQTPLTPGTVCWVTGWGATQERD----MASVLQELAVPLLDSEDCEKMYHTQGSSLSGERIIQ 246

  Fly   198 EKMICMSTTSG-KSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGF-PAVFTRISSYLDWI 260
            ..|:|.....| |.:|.||||||||....:|...:|.||:|  :||...: |.|:||:.:|:|||
Mouse   247 SDMLCAGYVEGQKDSCQGDSGGPLVCSINSSWTQVGITSWG--IGCARPYRPGVYTRVPTYVDWI 309

  Fly   261 LNHIIAHN 268
             ..|:|.|
Mouse   310 -QRILAEN 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 80/261 (31%)
Tryp_SPc 27..260 CDD:214473 78/258 (30%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 80/262 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.