DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Cela3b

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001100162.1 Gene:Cela3b / 298567 RGDID:1307819 Length:269 Species:Rattus norvegicus


Alignment Length:288 Identity:92/288 - (31%)
Similarity:147/288 - (51%) Gaps:39/288 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMKLLVCVLLV------GSCTAVPLLTDVEPYITNGEPAEVGQFPYQAGLNV-SFGNWSTWCGGT 58
            |::||..:|||      |..:..|     ...:.|||.|....:|:|..|.. ..|::...||||
  Rat     1 MLRLLCSLLLVALASGCGQPSYNP-----SSRVVNGEDAVPYSWPWQVSLQYEKDGSFHHTCGGT 60

  Fly    59 LISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSG-IIVHSNYMASTVV--NDI 120
            ||:..|::||.||:..:.:..|.||....|  .|||.|:::...:| :.||..:.::.|.  |||
  Rat    61 LIAPDWVMTAGHCISTSRTYQVVLGEFERG--VEEGPEQVIPVNAGDLFVHPKWNSNCVSCGNDI 123

  Fly   121 SLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESI----RAFASGWGRESDASDSVSPVLRYVEMP 181
            :|::|.......|.::.|.||       |..|.:    ..:.|||||.| .:..:...|:...:|
  Rat   124 ALVKLSRSAQLGDTVQLACLP-------PAGEILPNGAPCYISGWGRLS-TNGPLPDKLQQALLP 180

  Fly   182 IMPHSLCRM--YWSGAVSEKMICMSTTSG--KSTCHGDSGGPLVYKQGNSSYLI-GSTSFGTSMG 241
            ::.::.|..  :|..:|.:.|:|   ..|  :|.|:|||||||.....|.::.: |.|||.:|:|
  Rat   181 VVDYAHCSKWDWWGFSVKKTMVC---AGGDIQSGCNGDSGGPLNCPAENGTWQVHGVTSFVSSLG 242

  Fly   242 CQ-VGFPAVFTRISSYLDWILNHIIAHN 268
            |. :..|.||||:|::.:|| ...||:|
  Rat   243 CNTLKKPTVFTRVSAFNEWI-EETIANN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 81/249 (33%)
Tryp_SPc 27..260 CDD:214473 79/246 (32%)
Cela3bNP_001100162.1 Tryp_SPc 27..262 CDD:214473 79/247 (32%)
Tryp_SPc 28..265 CDD:238113 81/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.