DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Mcpt2

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:268 Identity:87/268 - (32%)
Similarity:131/268 - (48%) Gaps:38/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVCVLLVGSCTAVPLLTDVE--PYITNGEPAEVGQFPYQAGLN-VSFGNWSTWCGGTLISHYWII 66
            |:.:||.....|..::..||  |:          ..||.|.|: |:.......|||.|||..:::
  Rat     7 LMALLLPSGAGAEEIIGGVESIPH----------SRPYMAHLDIVTEKGLRVICGGFLISRQFVL 61

  Fly    67 TAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGF 131
            ||||| .|.| :||.|||.:: .:.|..|::|.|||.  |:|.:|.:...::||.|::|...|..
  Rat    62 TAAHC-KGRE-ITVILGAHDV-RKRESTQQKIKVEKQ--IIHESYNSVPNLHDIMLLKLEKKVEL 121

  Fly   132 TDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLC---RMYWS 193
            |..:....||...:...|   ....:|:|||: :...|..|..||.||:.||....|   |.|  
  Rat   122 TPAVNVVPLPSPSDFIHP---GAMCWAAGWGK-TGVRDPTSYTLREVELRIMDEKACVDYRYY-- 180

  Fly   194 GAVSEKMICM-STTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYL 257
              ..:..:|: |.|:.::...|||||||:.    :....|..|:|..   ....||:|||:|:|:
  Rat   181 --EYKFQVCVGSPTTLRAAFMGDSGGPLLC----AGVAHGIVSYGHP---DAKPPAIFTRVSTYV 236

  Fly   258 DWILNHII 265
            .|| |.:|
  Rat   237 PWI-NAVI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 78/240 (33%)
Tryp_SPc 27..260 CDD:214473 76/237 (32%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 79/248 (32%)
Tryp_SPc 21..242 CDD:238113 82/251 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.