DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Prss27

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:281 Identity:79/281 - (28%)
Similarity:127/281 - (45%) Gaps:38/281 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLVCVLLVGSCT--AVPLLTDVEPYITN----GEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISH 62
            ||:..||:.|.|  |..:.....|.:.|    ||.|..|::|:|..:.   .|.:.:|||:||:.
  Rat     9 LLLLPLLLRSGTEGAEAMRACGHPRMFNRMVGGEDALEGEWPWQVSIQ---RNGAHFCGGSLIAP 70

  Fly    63 YWIITAAHCMDGAESVTVY---LGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIR 124
            .|::|||||......:::|   |||:.:   .:.|...:.|....:..|..|.......|::|:.
  Rat    71 TWVLTAAHCFSNTSDISIYQVLLGALKL---QQPGPHALYVPVKRVKSHPEYQGMASSADVALVE 132

  Fly   125 LPAFVGFTDRIRAASLPRRLNGQFPTY---ESIRAFASGWGRESDASDSVSP-VLRYVEMPIMPH 185
            |...|.||..|....||.      |:.   ..:..:.:|||..|:.....:| :|:.:.:|::..
  Rat   133 LQVPVTFTKYILPVCLPD------PSVVFKSGMNCWVTGWGSPSEQDRLPNPRILQKLAVPLIDT 191

  Fly   186 SLCRMYWS---------GAVSEKMICMSTTSG-KSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSM 240
            ..|.:.:|         ..:.:.|:|.....| |..|.||||||||.....|....|..|:|.  
  Rat   192 PKCNLLYSKDAEADIQLKTIKDDMLCAGFAEGKKDACKGDSGGPLVCLVDQSWVQAGVISWGE-- 254

  Fly   241 GC-QVGFPAVFTRISSYLDWI 260
            || :...|.|:.|::|:..||
  Rat   255 GCARRNRPGVYIRVASHYQWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 71/256 (28%)
Tryp_SPc 27..260 CDD:214473 69/254 (27%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 68/251 (27%)
Tryp_SPc 39..278 CDD:238113 70/251 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.