DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Prss30

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:268 Identity:79/268 - (29%)
Similarity:122/268 - (45%) Gaps:47/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWIITAAHCMDGAESVTVY---LGAINIG 88
            |..|:.|..|::|:|..|...  .....|||:||...|::|||||.....:.:.|   :|.:.: 
  Rat    31 IVGGQDAPEGRWPWQVSLRTE--KEGHICGGSLIHEVWVLTAAHCFCRPLNSSFYHVKVGGLTL- 92

  Fly    89 DESEEGQERIMVEKSGIIVHSNYM---ASTVVNDISLIRL-----PAFVGFTDRIRAASLPRRLN 145
              |.......:|....|.|:..|:   ||:  .||:|:||     |:      :.....||:   
  Rat    93 --SLTEPHSTLVAVRNIFVYPTYLWEDASS--GDIALLRLDTPLQPS------QFSPVCLPQ--- 144

  Fly   146 GQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLC-RMYWSG--------AVSEKMI 201
            .|.|.......:.:|||...:.  .::.||:.:.:|::....| |||..|        .:...|:
  Rat   145 AQAPLTPGTVCWVTGWGATHER--ELASVLQELAVPLLDSEDCERMYHIGETSLSGKRVIQSDML 207

  Fly   202 CMSTTSG-KSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGC-QVGFPAVFTRISSYLDWIL--- 261
            |.....| |.:|.||||||||....:|...:|.||:|  :|| :...|.|:||:..|:|||.   
  Rat   208 CAGFVEGQKDSCQGDSGGPLVCAINSSWIQVGITSWG--IGCARPNKPGVYTRVPDYVDWIQRTL 270

  Fly   262 --NHIIAH 267
              ||..|:
  Rat   271 AENHSDAY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 76/262 (29%)
Tryp_SPc 27..260 CDD:214473 74/254 (29%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.