DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and CG30082

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:254 Identity:81/254 - (31%)
Similarity:121/254 - (47%) Gaps:38/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWIITAAHCMDGAESVTVYLG----AINI 87
            |..|..|::|..|:.|.|:   .|.|..|.||||:..:::|||||:.....:||.||    :..|
  Fly    40 IVGGRTADIGSNPWLAYLH---KNSSLVCTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRI 101

  Fly    88 GDESE---EGQERIMVEKSGIIVHSNYMA-STVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQF 148
            ...||   ...|...||.:  .:|:.:.. ....|||.|::|...|.:...||...|.|. .||.
  Fly   102 DCTSEFCIPTYEEYSVENA--YIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRD-PGQV 163

  Fly   149 P---TYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGAVSEKMICMSTTSGK- 209
            |   |||     |:|||: .|..::.: ||:.|.:..:..|.|......::|....|    :|: 
  Fly   164 PYSSTYE-----AAGWGK-IDLINTAT-VLQTVNLIRLDQSDCERSLRTSLSYGQFC----AGQW 217

  Fly   210 --STCHGDSGGPLVYKQGNS----SYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWILN 262
              .||.|||||||..|..|.    :..:|..|:|..: |:  .|.|:|.:.|:.:|||:
  Fly   218 RADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYL-CR--GPGVYTYVPSFTNWILS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 81/254 (32%)
Tryp_SPc 27..260 CDD:214473 78/250 (31%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 78/250 (31%)
Tryp_SPc 40..274 CDD:238113 81/254 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436338
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.