DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Cela1

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_036684.1 Gene:Cela1 / 24331 RGDID:2547 Length:266 Species:Rattus norvegicus


Alignment Length:278 Identity:93/278 - (33%)
Similarity:145/278 - (52%) Gaps:22/278 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMKLLVCVLLVGSCTAVPLLTDVEPYITNGEPAEVGQFPYQAGLN-VSFGNWSTWCGGTLISHYW 64
            |::.||...||....:.....:....:..|..|....:|.|..|. :|.|:|...||||||...|
  Rat     1 MLRFLVFASLVLYGHSTQDFPETNARVVGGAEARRNSWPSQISLQYLSGGSWYHTCGGTLIRRNW 65

  Fly    65 IITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVV--NDISLIRLPA 127
            ::|||||:....:..|.:|..|: .:::..::.:.|:|  |:||.|:.::.|.  .||:|:||..
  Rat    66 VMTAAHCVSSQMTFRVVVGDHNL-SQNDGTEQYVSVQK--IVVHPNWNSNNVAAGYDIALLRLAQ 127

  Fly   128 FVGFTDRIRAASLPRR---LNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLC- 188
            .|...:.::.|.||:.   |....|.|      .:|||| :..:..:|..|:...:|.:.:|:| 
  Rat   128 SVTLNNYVQLAVLPQEGTILANNNPCY------ITGWGR-TRTNGQLSQTLQQAYLPSVDYSICS 185

  Fly   189 -RMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLI-GSTSFGTSMGCQVG-FPAVF 250
             ..||...|...|:|......:|.|.||||||| :...|..|.: |.|||.:||||.|. .|.||
  Rat   186 SSSYWGSTVKTTMVCAGGDGVRSGCQGDSGGPL-HCLVNGQYSVHGVTSFVSSMGCNVSRKPTVF 249

  Fly   251 TRISSYLDWILNHIIAHN 268
            ||:|:|:.| :|::||:|
  Rat   250 TRVSAYISW-MNNVIAYN 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 84/245 (34%)
Tryp_SPc 27..260 CDD:214473 83/242 (34%)
Cela1NP_036684.1 Tryp_SPc 26..258 CDD:214473 83/242 (34%)
Tryp_SPc 27..262 CDD:238113 85/246 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.