DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Ctrb1

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_036668.1 Gene:Ctrb1 / 24291 RGDID:2444 Length:263 Species:Rattus norvegicus


Alignment Length:266 Identity:85/266 - (31%)
Similarity:138/266 - (51%) Gaps:24/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLVCVLLVGS---C---TAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISH 62
            |:.|..|||:   |   |..|:||.:. .|.|||.|..|.:|:|..|....|  ..:|||:|||.
  Rat     6 LVSCFALVGATFGCGVPTIQPVLTGLS-RIVNGEDAIPGSWPWQVSLQDKTG--FHFCGGSLISE 67

  Fly    63 YWIITAAHCMDGAESVTVYLGAINIGDESEEG--QERIMVEK-SGIIVHSNYMASTVVNDISLIR 124
            .|::|||||  |.::..|.     :..|.::|  :|.|.|.| :.:..:..:...||.|||:|::
  Rat    68 DWVVTAAHC--GVKTSDVV-----VAGEFDQGSDEENIQVLKIAQVFKNPKFNMFTVRNDITLLK 125

  Fly   125 LPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCR 189
            |.....|::.:.|..|| .::..||  .......:|||:....:......|:...:||:..:.|:
  Rat   126 LATPAQFSETVSAVCLP-NVDDDFP--PGTVCATTGWGKTKYNALKTPEKLQQAALPIVSEADCK 187

  Fly   190 MYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRIS 254
            ..|...:::.|.| :..||.|:|.||||||||.::.....|.|..|:|:.: |....|||::|::
  Rat   188 KSWGSKITDVMTC-AGASGVSSCMGDSGGPLVCQKDGVWTLAGIVSWGSGV-CSTSTPAVYSRVT 250

  Fly   255 SYLDWI 260
            :.:.|:
  Rat   251 ALMPWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 75/237 (32%)
Tryp_SPc 27..260 CDD:214473 74/235 (31%)
Ctrb1NP_036668.1 Tryp_SPc 33..256 CDD:214473 74/236 (31%)
Tryp_SPc 34..259 CDD:238113 75/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.