DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Cela3a

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001119790.1 Gene:Cela3a / 242711 MGIID:3651647 Length:283 Species:Mus musculus


Alignment Length:299 Identity:88/299 - (29%)
Similarity:139/299 - (46%) Gaps:47/299 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMKLLVCVLLV------GSCTAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSF-GNWSTWCGGT 58
            |::||..:|||      |..:..|     ...:.|||.|....:|:|..|.... |::...|||:
Mouse     1 MLRLLSSLLLVALASGCGQPSHNP-----SSRVVNGEEAVPHSWPWQVSLQYEMGGSFHHTCGGS 60

  Fly    59 LISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSG-IIVHSNYMASTV--VNDI 120
            ||:..|::||.||:....:..|.||....|  .|||.|:::...:| :.||..:.:..|  .|:|
Mouse    61 LITPDWVLTAGHCIMPYLNYRVVLGEHEHG--VEEGSEQVIPINAGELFVHPKWNSECVNCGNNI 123

  Fly   121 SLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESI----RAFASGWGRESDASDSVSPVLRYVEMP 181
            :|::|.......|.::.|.||       |..|.:    ..:.|||||.| .:..:...|:...:|
Mouse   124 ALVKLSRSAQLGDAVQLACLP-------PAGEILPNGAPCYISGWGRLS-TNGPLPTKLQQALLP 180

  Fly   182 IMPHSLCRM--YWSGAVSEKMIC----MSTTSGKSTCH---------GDSGGPLVYKQGNSSYLI 231
            ::.:..|..  :|...|...|:|    :...|..|..|         |||||||.....|.::.:
Mouse   181 VVDYEHCSRWDWWGHYVKRTMVCAGGYIQAHSLSSDTHQPRLLSPLQGDSGGPLNCPADNGTWQV 245

  Fly   232 -GSTSFGTSMGCQ-VGFPAVFTRISSYLDWILNHIIAHN 268
             |..||.:..||. :..|.:|||:|:::||| ...||:|
Mouse   246 HGIASFVSPSGCNTLKKPTMFTRVSAFIDWI-EETIANN 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 77/260 (30%)
Tryp_SPc 27..260 CDD:214473 75/257 (29%)
Cela3aNP_001119790.1 Tryp_SPc 27..276 CDD:214473 75/258 (29%)
Tryp_SPc 28..279 CDD:238113 77/261 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.