DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and Klk7

DIOPT Version :10

Sequence 1:NP_648995.3 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_036002.1 Gene:Klk7 / 23993 MGIID:1346336 Length:249 Species:Mus musculus


Alignment Length:122 Identity:25/122 - (20%)
Similarity:37/122 - (30%) Gaps:54/122 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VEANAATQGKNTTI--------------------PALIVFGDSIMDTGNNNNLP--TLLKCNF-- 55
            |.|.:.|||...|.                    |...|.|::   |.|..|.|  .::|.:.  
Mouse   543 VNATSQTQGSVETAREPTGAQLTSSMTSAVSSEPPPAAVMGNT---TQNGENKPPQAIVKPHVLT 604

  Fly    56 -------------------PPYGKDYPGGFATGRFSDGRVPSDLIAEKLGLAKTLPA 93
                               ||...:.|      :..|.::|||  .||...:.:|.|
Mouse   605 HVIEGFVIQEGAEPFPVERPPVAAESP------KKPDTQLPSD--PEKTASSNSLSA 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_648995.3 Tryp_SPc 27..263 CDD:238113 20/110 (18%)
Klk7NP_036002.1 Tryp_SPc 25..241 CDD:214473
Serine protease. /evidence=ECO:0000250 26..246
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.