DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7542 and TPSD1

DIOPT Version :9

Sequence 1:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:245 Identity:72/245 - (29%)
Similarity:115/245 - (46%) Gaps:30/245 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MKLLVCVLLVGSCTAVPLLTD---VEPY---------ITNGEPAEVGQFPYQAGLNVSFGNWSTW 54
            |.||...:|.....|:|:|..   |.|.         |..|:.|...::|:|..|.|....|..:
Human     1 MLLLAPQMLSLLLLALPVLASPAYVAPAPGQALQQTGIVGGQEAPRSKWPWQVSLRVRGPYWMHF 65

  Fly    55 CGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVND 119
            |||:||...|::|||||::........| .:.:.::....|:::: ..|.||||..:.......|
Human    66 CGGSLIHPQWVLTAAHCVEPDIKDLAAL-RVQLREQHLYYQDQLL-PVSRIIVHPQFYIIQTGAD 128

  Fly   120 ISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSP--VLRYVEMPI 182
            |:|:.|...|..:..|...:|| ..:..||  ..:..:.:||| :.|.:..:.|  .|:.||:|:
Human   129 IALLELEEPVNISSHIHTVTLP-PASETFP--PGMPCWVTGWG-DVDNNVHLPPPYPLKEVEVPV 189

  Fly   183 MPHSLCRM-YWSG--------AVSEKMICMSTTSGKSTCHGDSGGPLVYK 223
            :.:.||.. |.:|        .|.:.|:|..:.:..| |.||||||||.|
Human   190 VENHLCNAEYHTGLHTGHSFQIVRDDMLCAGSENHDS-CQGDSGGPLVCK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 63/208 (30%)
Tryp_SPc 27..260 CDD:214473 63/208 (30%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 63/208 (30%)
Tryp_SPc 38..240 CDD:214473 63/208 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.